Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) automatically mapped to Pfam PF00333 |
Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
Domain d2ow8f2: 2ow8 f:5-73 [139403] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1 automatically matched to d1i94e2 protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8f2 d.50.1.2 (f:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d2ow8f2: