Lineage for d2ow8f2 (2ow8 f:5-73)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859886Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 859887Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 859959Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 859960Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 859988Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 860020Domain d2ow8f2: 2ow8 f:5-73 [139403]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1i94e2
    complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8f2

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (f:) 30S ribosomal protein S5

SCOP Domain Sequences for d2ow8f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8f2 d.50.1.2 (f:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d2ow8f2:

Click to download the PDB-style file with coordinates for d2ow8f2.
(The format of our PDB-style files is described here.)

Timeline for d2ow8f2: