Lineage for d2ow8e1 (2ow8 e:2-209)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864567Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 864568Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 864569Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 864570Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 864601Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 864642Domain d2ow8e1: 2ow8 e:2-209 [139401]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    automatically matched to d1hnwd_
    complexed with 2mg, 4oc, 4su, 5mc, 5mu, 7mg, h2u, m2g, ma6, mia, psu, ur3

Details for d2ow8e1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (e:) 30S ribosomal protein S4

SCOP Domain Sequences for d2ow8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8e1 d.66.1.2 (e:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d2ow8e1:

Click to download the PDB-style file with coordinates for d2ow8e1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8e1: