SCOPe 2.08: Domain d2ovra2: 2ovr A:1002-1065

Lineage for d2ovra2 (2ovr A:1002-1065)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)

8. Domain d2ovra2: 2ovr A:1002-1065 [139387]
   Other proteins in same PDB: d2ovra1, d2ovrb1, d2ovrb2
   automatically matched to d1fqvb2
   complexed with so4
   missing some secondary structures that made up less than one-third of the common domain

Details for d2ovra2

PDB Entry: 2ovr, 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex

PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovra2:

Sequence; same for both SEQRES and ATOM records:

>d2ovra2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

Timeline for d2ovra2:

• d2ovra2 first appeared in SCOP 1.73
  
• d2ovra2 appears in SCOPe 2.07