Lineage for d2ovqa2 (2ovq A:1002-1065)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859355Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 859356Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 859357Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 859377Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 859378Species Human (Homo sapiens) [TaxId:9606] [54711] (8 PDB entries)
  8. 859390Domain d2ovqa2: 2ovq A:1002-1065 [139385]
    Other proteins in same PDB: d2ovqa1, d2ovqb1, d2ovqb2
    automatically matched to d1fqvb2
    complexed with so4

Details for d2ovqa2

PDB Entry: 2ovq (more details), 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOP Domain Sequences for d2ovqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovqa2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

SCOP Domain Coordinates for d2ovqa2:

Click to download the PDB-style file with coordinates for d2ovqa2.
(The format of our PDB-style files is described here.)

Timeline for d2ovqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovqa1