Lineage for d2ovpa2 (2ovp A:1002-1065)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945520Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 2945521Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)
  8. 2945536Domain d2ovpa2: 2ovp A:1002-1065 [139383]
    Other proteins in same PDB: d2ovpa1, d2ovpb1, d2ovpb2
    automated match to d1fqvb2
    missing some secondary structures that made up less than one-third of the common domain

Details for d2ovpa2

PDB Entry: 2ovp (more details), 2.9 Å

PDB Description: Structure of the Skp1-Fbw7 complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovpa2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

SCOPe Domain Coordinates for d2ovpa2:

Click to download the PDB-style file with coordinates for d2ovpa2.
(The format of our PDB-style files is described here.)

Timeline for d2ovpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovpa1