Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
Domain d2ovpa2: 2ovp A:1002-1065 [139383] Other proteins in same PDB: d2ovpa1, d2ovpb1, d2ovpb2 automated match to d1fqvb2 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2ovp (more details), 2.9 Å
SCOPe Domain Sequences for d2ovpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovpa2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh
Timeline for d2ovpa2: