Lineage for d2ouza1 (2ouz A:306-550)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647893Protein Estrogen receptor alpha [48519] (1 species)
  7. 647894Species Human (Homo sapiens) [TaxId:9606] [48520] (22 PDB entries)
  8. 647902Domain d2ouza1: 2ouz A:306-550 [139378]
    automatically matched to d1qkua_
    complexed with c3d

Details for d2ouza1

PDB Entry: 2ouz (more details), 2 Å

PDB Description: crystal structure of estrogen receptor alpha-lasofoxifene complex
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d2ouza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouza1 a.123.1.1 (A:306-550) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
ahrlh

SCOP Domain Coordinates for d2ouza1:

Click to download the PDB-style file with coordinates for d2ouza1.
(The format of our PDB-style files is described here.)

Timeline for d2ouza1: