SCOPe 2.03: Domain d2otva_: 2otv A:

Lineage for d2otva_ (2otv A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d2otva_: 2otv A: [139372]
   automated match to d1aq7__
   complexed with ca, nca, so4

Details for d2otva_

PDB Entry: 2otv, 1.56 Å

PDB Description: crystal structure of the complex formed between bovine trypsin and nicotinamide at 1.56 a resolution

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2otva_:

Sequence; same for both SEQRES and ATOM records:

>d2otva_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2otva_:

• d2otva_ first appeared in SCOP 1.73, called d2otva1
  
• d2otva_ appears in SCOPe 2.02
  
• d2otva_ appears in SCOPe 2.04
  
• d2otva_ appears in the current release, SCOPe 2.08