| Class g: Small proteins [56992] (85 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) ![]() |
| Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) |
| Protein Ribosomal protein L24e [57750] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries) |
| Domain d2otlu1: 2otl U:4-56 [139366] Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1ffkr_ complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2otl (more details), 2.7 Å
SCOP Domain Sequences for d2otlu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otlu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d2otlu1:
View in 3DDomains from other chains: (mouse over for more information) d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |