SCOPe 2.06: Domain d2otli1: 2otl I:71-140

Lineage for d2otli1 (2otl I:71-140)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d2otli1: 2otl I:71-140 [139354]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1s72i_
   complexed with cd, cl, gir, k, mg, na

Details for d2otli1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d2otli1:

Sequence; same for both SEQRES and ATOM records:

>d2otli1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

Timeline for d2otli1:

• d2otli1 first appeared in SCOP 1.73
  
• d2otli1 appears in SCOPe 2.05
  
• d2otli1 appears in SCOPe 2.07
  
• d2otli1 appears in the current release, SCOPe 2.08