Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
Domain d2otli1: 2otl I:71-140 [139354] Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1s72i_ complexed with cd, cl, gir, k, mg, na |
PDB Entry: 2otl (more details), 2.7 Å
SCOPe Domain Sequences for d2otli1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otli1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]} gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg tctslgvtie
Timeline for d2otli1:
View in 3D Domains from other chains: (mouse over for more information) d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |