SCOPe 2.08: Domain d2otjv1: 2otj V:1-65

Lineage for d2otjv1 (2otj V:1-65)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
   Uniprot P10971

8. Domain d2otjv1: 2otj V:1-65 [139338]
   Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1ffks_
   complexed with 13t, cd, cl, k, mg, na

Details for d2otjv1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d2otjv1:

Sequence; same for both SEQRES and ATOM records:

>d2otjv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d2otjv1:

• d2otjv1 first appeared in SCOP 1.73
  
• d2otjv1 appears in SCOPe 2.07