SCOP 1.75: Domain d2otja1: 2otj A:91-237

Lineage for d2otja1 (2otj A:91-237)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
   Uniprot P20276

8. Domain d2otja1: 2otj A:91-237 [139316]
   Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1s72a1
   complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otja1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d2otja1:

Sequence; same for both SEQRES and ATOM records:

>d2otja1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d2otja1:

• d2otja1 first appeared in SCOP 1.73
  
• d2otja1 appears in SCOPe 2.01
  
• d2otja1 appears in the current release, SCOPe 2.08