Lineage for d2osna_ (2osn A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925605Species Bungarus caeruleus [TaxId:132961] [187166] (1 PDB entry)
  8. 925606Domain d2osna_: 2osn A: [139300]
    automated match to d1g2xa_
    complexed with cl

Details for d2osna_

PDB Entry: 2osn (more details), 2.5 Å

PDB Description: an alternate description of a crystal structure of phospholipase a2 from bungarus caeruleus
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d2osna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2osna_ a.133.1.2 (A:) automated matches {Bungarus caeruleus [TaxId: 132961]}
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

SCOPe Domain Coordinates for d2osna_:

Click to download the PDB-style file with coordinates for d2osna_.
(The format of our PDB-style files is described here.)

Timeline for d2osna_: