Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
Protein automated matches [190139] (19 species) not a true protein |
Species Bungarus caeruleus [TaxId:132961] [187166] (1 PDB entry) |
Domain d2osna_: 2osn A: [139300] automated match to d1g2xa_ complexed with cl |
PDB Entry: 2osn (more details), 2.5 Å
SCOPe Domain Sequences for d2osna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2osna_ a.133.1.2 (A:) automated matches {Bungarus caeruleus [TaxId: 132961]} nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq
Timeline for d2osna_: