Lineage for d2orka2 (2ork A:205-234)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2265468Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2265469Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2265541Protein Surfactant protein [57949] (2 species)
  7. 2265542Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 2265585Domain d2orka2: 2ork A:205-234 [139268]
    Other proteins in same PDB: d2orka1, d2orkb1, d2orkc1
    complexed with ca, ipd

Details for d2orka2

PDB Entry: 2ork (more details), 1.89 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with inositol-1-phosphate
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2orka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2orka2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d2orka2:

Click to download the PDB-style file with coordinates for d2orka2.
(The format of our PDB-style files is described here.)

Timeline for d2orka2: