Lineage for d2oqia2 (2oqi A:509-764)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152172Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2152179Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2152180Species Human (Homo sapiens) [TaxId:9606] [82499] (55 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2152289Domain d2oqia2: 2oqi A:509-764 [139241]
    Other proteins in same PDB: d2oqia1, d2oqib1, d2oqic1, d2oqid1
    automated match to d1tk3a2
    complexed with ggo

Details for d2oqia2

PDB Entry: 2oqi (more details), 2.8 Å

PDB Description: human dipeptidyl peptidase iv (dpp4) with piperidinone-constrained phenethylamine
PDB Compounds: (A:) Dipeptidyl peptidase 4 (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP)

SCOPe Domain Sequences for d2oqia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqia2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOPe Domain Coordinates for d2oqia2:

Click to download the PDB-style file with coordinates for d2oqia2.
(The format of our PDB-style files is described here.)

Timeline for d2oqia2: