Lineage for d2oqea2 (2oqe A:18-115)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718737Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 718903Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 718904Domain d2oqea2: 2oqe A:18-115 [139223]
    Other proteins in same PDB: d2oqea1, d2oqeb1, d2oqec1, d2oqed1, d2oqee1, d2oqef1
    automatically matched to d1ekma2
    complexed with cu, gol, sme, xe

Details for d2oqea2

PDB Entry: 2oqe (more details), 1.6 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase in complex with xe to 1.6 angstroms
PDB Compounds: (A:) Peroxisomal copper amine oxidase

SCOP Domain Sequences for d2oqea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqea2 d.17.2.1 (A:18-115) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
layyvileagkpgvkeglvdlaslsvietraletvqpi

SCOP Domain Coordinates for d2oqea2:

Click to download the PDB-style file with coordinates for d2oqea2.
(The format of our PDB-style files is described here.)

Timeline for d2oqea2: