SCOPe 2.01: Domain d2opob_: 2opo B:

Lineage for d2opob_ (2opo B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.10: Polcalcin [89048] (3 proteins)
   calcium-binding pollen allergen; two EF-hands per subunit

6. Protein Polcalcin Che a 3 [109816] (1 species)

7. Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (1 PDB entry)
   Uniprot Q84V36

8. Domain d2opob_: 2opo B: [139210]
   automated match to d1pmzc_
   complexed with ca, so4

Details for d2opob_

PDB Entry: 2opo, 1.75 Å

PDB Description: Crystal structure of the calcium-binding pollen allergen Che a 3

PDB Compounds: (B:) Polcalcin Che a 3

SCOPe Domain Sequences for d2opob_:

Sequence; same for both SEQRES and ATOM records:

>d2opob_ a.39.1.10 (B:) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
tpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfisf
deftdfaranrglvkdvskif

Timeline for d2opob_:

• d2opob_ first appeared in SCOP 1.73, called d2opob1
  
• d2opob_ was called d2opob1 in SCOP 1.75
  
• d2opob_ appears in SCOPe 2.02
  
• d2opob_ appears in the current release, SCOPe 2.08