Lineage for d2oove3 (2oov E:116-236)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935960Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2935961Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2935962Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2936170Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. 2936192Domain d2oove3: 2oov E:116-236 [139193]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1a2va3
    complexed with cu, gol, po4

Details for d2oove3

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (E:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oove3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oove3 d.17.2.1 (E:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOPe Domain Coordinates for d2oove3:

Click to download the PDB-style file with coordinates for d2oove3.
(The format of our PDB-style files is described here.)

Timeline for d2oove3: