Lineage for d2onlc1 (2onl C:46-385)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220979Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 1220980Species Human (Homo sapiens) [TaxId:9606] [82790] (5 PDB entries)
  8. 1220989Domain d2onlc1: 2onl C:46-385 [139160]
    Other proteins in same PDB: d2onla1, d2onlb1
    automatically matched to d1kwpa_

Details for d2onlc1

PDB Entry: 2onl (more details), 4 Å

PDB Description: crystal structure of the p38a-mapkap kinase 2 heterodimer
PDB Compounds: (C:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d2onlc1:

Sequence, based on SEQRES records: (download)

>d2onlc1 d.144.1.7 (C:46-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterease
imksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcy
tpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqye
fpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
kerwedvkeemtsalatmrvdyeqikikkiedasnplllk

Sequence, based on observed residues (ATOM records): (download)

>d2onlc1 d.144.1.7 (C:46-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddykvkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcph
ivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqy
lhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlg
pekydkscdmwslgvimyillcgyppfyefpnpewsevseevkmlirnllkteptqrmti
tefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrvdyeqikikkie
dasnplllk

SCOPe Domain Coordinates for d2onlc1:

Click to download the PDB-style file with coordinates for d2onlc1.
(The format of our PDB-style files is described here.)

Timeline for d2onlc1: