Lineage for d2om9d_ (2om9 D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924163Domain d2om9d_: 2om9 D: [139145]
    automated match to d3prga_
    complexed with aja

Details for d2om9d_

PDB Entry: 2om9 (more details), 2.8 Å

PDB Description: ajulemic acid, a synthetic cannabinoid bound to ppar gamma
PDB Compounds: (D:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2om9d_:

Sequence, based on SEQRES records: (download)

>d2om9d_ a.123.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d2om9d_ a.123.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtkspfviydmnslmmgedkikfkhitpke
vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
kktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d2om9d_:

Click to download the PDB-style file with coordinates for d2om9d_.
(The format of our PDB-style files is described here.)

Timeline for d2om9d_: