SCOPe 2.03: Domain d2ol3l_: 2ol3 L:

Lineage for d2ol3l_ (2ol3 L:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d2ol3l_: 2ol3 L: [139134]
   Other proteins in same PDB: d2ol3a1, d2ol3b_, d2ol3h1, d2ol3h2
   automated match to d1bz9b_
   complexed with nag

Details for d2ol3l_

PDB Entry: 2ol3, 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule

PDB Compounds: (L:) Beta-2-microglobulin

SCOPe Domain Sequences for d2ol3l_:

Sequence; same for both SEQRES and ATOM records:

>d2ol3l_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2ol3l_:

• d2ol3l_ first appeared in SCOP 1.73, called d2ol3l1
  
• d2ol3l_ appears in SCOPe 2.02
  
• d2ol3l_ appears in SCOPe 2.04
  
• d2ol3l_ appears in the current release, SCOPe 2.08, called d2ol3l2