Lineage for d2ol3h1 (2ol3 H:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654817Domain d2ol3h1: 2ol3 H:182-274 [139132]
    Other proteins in same PDB: d2ol3a1, d2ol3b1, d2ol3h2, d2ol3l1
    automatically matched to d1ddha1
    complexed with nag

Details for d2ol3h1

PDB Entry: 2ol3 (more details), 2.9 Å

PDB Description: crystal structure of bm3.3 scfv tcr in complex with pbm8-h-2kbm8 mhc class i molecule
PDB Compounds: (H:) allogeneic h-2kbm8 MHC class I molecule

SCOP Domain Sequences for d2ol3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol3h1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d2ol3h1:

Click to download the PDB-style file with coordinates for d2ol3h1.
(The format of our PDB-style files is described here.)

Timeline for d2ol3h1: