| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries) |
| Domain d2ol3b_: 2ol3 B: [139131] Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l_ automated match to d1namb_ complexed with nag |
PDB Entry: 2ol3 (more details), 2.9 Å
SCOPe Domain Sequences for d2ol3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ol3b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv
Timeline for d2ol3b_:
View in 3DDomains from other chains: (mouse over for more information) d2ol3a1, d2ol3h1, d2ol3h2, d2ol3l_ |