Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (19 PDB entries) |
Domain d2ol3b1: 2ol3 B:1-117 [139131] Other proteins in same PDB: d2ol3h1, d2ol3h2, d2ol3l1 automatically matched to d1namb_ complexed with nag |
PDB Entry: 2ol3 (more details), 2.9 Å
SCOP Domain Sequences for d2ol3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ol3b1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv
Timeline for d2ol3b1:
View in 3D Domains from other chains: (mouse over for more information) d2ol3a1, d2ol3h1, d2ol3h2, d2ol3l1 |