SCOP 1.75: Domain d2ojfe1: 2ojf E:15-350

Lineage for d2ojfe1 (2ojf E:15-350)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries)
   Uniprot P00517

8. Domain d2ojfe1: 2ojf E:15-350 [139113]
   automatically matched to d1q8ua_
   complexed with 4py

Details for d2ojfe1

PDB Entry: 2ojf, 2.1 Å

PDB Description: Crystal structure of Protein Kinase A in complex with Pyridine-Pyrazolopyridine based inhibitors

PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d2ojfe1:

Sequence; same for both SEQRES and ATOM records:

>d2ojfe1 d.144.1.7 (E:15-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d2ojfe1:

• d2ojfe1 first appeared in SCOP 1.73
  
• d2ojfe1 is called d2ojfe_ in SCOPe 2.01
  
• d2ojfe1 appears in the current release, SCOPe 2.08, called d2ojfe_