Lineage for d2ojef1 (2oje F:93-190)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515012Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1515020Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1515068Domain d2ojef1: 2oje F:93-190 [139110]
    Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb2, d2ojed1, d2ojee1, d2ojee2, d2ojef2, d2ojeh1
    automatically matched to d1d5xb1
    complexed with po4

Details for d2ojef1

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (F:) HLA class II histocompatibility antigen, DRB1-1 beta chain precursor

SCOPe Domain Sequences for d2ojef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojef1 b.1.1.2 (F:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2ojef1:

Click to download the PDB-style file with coordinates for d2ojef1.
(The format of our PDB-style files is described here.)

Timeline for d2ojef1: