Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries) |
Domain d2ojee2: 2oje E:13-81 [139109] Other proteins in same PDB: d2ojea1, d2ojeb1, d2ojeb2, d2ojed1, d2ojee1, d2ojef1, d2ojef2, d2ojeh1 automatically matched to d1k2da2 complexed with po4 |
PDB Entry: 2oje (more details), 3 Å
SCOPe Domain Sequences for d2ojee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ojee2 d.19.1.1 (E:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei mtkrsnytp
Timeline for d2ojee2: