SCOPe 2.06: Domain d2ojee1: 2oje E:83-179

Lineage for d2ojee1 (2oje E:83-179)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2ojee1: 2oje E:83-179 [139108]
   Other proteins in same PDB: d2ojea2, d2ojeb1, d2ojeb2, d2ojed1, d2ojee2, d2ojef1, d2ojef2, d2ojeh1
   automatically matched to d1k2da1
   complexed with po4

Details for d2ojee1

PDB Entry: 2oje, 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA

PDB Compounds: (E:) HLA class II histocompatibility antigen, DR alpha chain precursor

SCOPe Domain Sequences for d2ojee1:

Sequence; same for both SEQRES and ATOM records:

>d2ojee1 b.1.1.2 (E:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d2ojee1:

• d2ojee1 first appeared in SCOP 1.73
  
• d2ojee1 appears in SCOPe 2.05
  
• d2ojee1 appears in SCOPe 2.07
  
• d2ojee1 appears in the current release, SCOPe 2.08