SCOP 1.73: Domain d2oj3a1: 2oj3 A:4-98

Lineage for d2oj3a1 (2oj3 A:4-98)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries)

8. Domain d2oj3a1: 2oj3 A:4-98 [139101]
   automatically matched to d1auda_
   complexed with nco, tl; mutant

Details for d2oj3a1

PDB Entry: 2oj3, 2.9 Å

PDB Description: Hepatitis Delta Virus ribozyme precursor structure, with C75U mutation, bound to Tl+ and cobalt hexammine (Co(NH3)63+)

PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOP Domain Sequences for d2oj3a1:

Sequence; same for both SEQRES and ATOM records:

>d2oj3a1 d.58.7.1 (A:4-98) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

Timeline for d2oj3a1:

• d2oj3a1 is new in SCOP 1.73
  
• d2oj3a1 appears in SCOP 1.75
  
• d2oj3a1 appears in the current release, SCOPe 2.08, called d2oj3a_