Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Splicesomal U1A protein [54932] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries) |
Domain d2oj3a1: 2oj3 A:4-98 [139101] automatically matched to d1auda_ complexed with nco, tl; mutant |
PDB Entry: 2oj3 (more details), 2.9 Å
SCOP Domain Sequences for d2oj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oj3a1 d.58.7.1 (A:4-98) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs satnalrsmqgfpfydkpmriqyaktdsdiiakmk
Timeline for d2oj3a1: