SCOPe 2.03: Domain d2ofua_: 2ofu A:

Lineage for d2ofua_ (2ofu A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (34 PDB entries)

8. Domain d2ofua_: 2ofu A: [139056]
   automated match to d1qpca_
   complexed with 1n9, so4

Details for d2ofua_

PDB Entry: 2ofu, 2 Å

PDB Description: x-ray crystal structure of 2-aminopyrimidine carbamate 43 bound to Lck

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2ofua_:

Sequence; same for both SEQRES and ATOM records:

>d2ofua_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
pqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflae
anlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqi
aegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwta
peainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpee
lyqlmrlcwkerpedrptfdylrsvledfftat

Timeline for d2ofua_:

• d2ofua_ first appeared in SCOP 1.73, called d2ofua1
  
• d2ofua_ appears in SCOPe 2.02
  
• d2ofua_ appears in SCOPe 2.04
  
• d2ofua_ appears in the current release, SCOPe 2.08