Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries) Uniprot O69250 |
Domain d2oenl_: 2oen L: [139040] Other proteins in same PDB: d2oeng_ automated match to d1kklj_ |
PDB Entry: 2oen (more details), 3.17 Å
SCOPe Domain Sequences for d2oenl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oenl_ d.94.1.1 (L:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]} aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati tisaegsdeadalaaledtmskeglge
Timeline for d2oenl_: