SCOP 1.75: Domain d2oenl1: 2oen L:2-88

Lineage for d2oenl1 (2oen L:2-88)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
   Uniprot O69250

8. Domain d2oenl1: 2oen L:2-88 [139040]
   Other proteins in same PDB: d2oeng1
   automatically matched to d1rzrl_

Details for d2oenl1

PDB Entry: 2oen, 3.17 Å

PDB Description: Structural mechanism for the fine-tuning of CcpA function by the small molecule effectors glucose-6-phosphate and fructose-1,6-bisphosphate

PDB Compounds: (L:) Phosphocarrier protein HPr

SCOP Domain Sequences for d2oenl1:

Sequence; same for both SEQRES and ATOM records:

>d2oenl1 d.94.1.1 (L:2-88) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

Timeline for d2oenl1:

• d2oenl1 first appeared in SCOP 1.73
  
• d2oenl1 appears in SCOPe 2.01
  
• d2oenl1 appears in the current release, SCOPe 2.08, called d2oenl_