Lineage for d2oeng_ (2oen G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161493Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 2161494Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 2161526Domain d2oeng_: 2oen G: [139039]
    Other proteins in same PDB: d2oenl_
    automated match to d2nzug_

Details for d2oeng_

PDB Entry: 2oen (more details), 3.17 Å

PDB Description: Structural mechanism for the fine-tuning of CcpA function by the small molecule effectors glucose-6-phosphate and fructose-1,6-bisphosphate
PDB Compounds: (G:) Catabolite control protein

SCOPe Domain Sequences for d2oeng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oeng_ c.93.1.1 (G:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d2oeng_:

Click to download the PDB-style file with coordinates for d2oeng_.
(The format of our PDB-style files is described here.)

Timeline for d2oeng_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oenl_