Lineage for d2ocyb1 (2ocy B:17-162)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266811Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 2266812Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 2266813Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)
  7. 2266814Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
    Uniprot P17065 16-162! Uniprot P17065 31-144
  8. 2266819Domain d2ocyb1: 2ocy B:17-162 [139022]
    Other proteins in same PDB: d2ocya2, d2ocyb2, d2ocyc1
    automatically matched to 2OCY A:16-162

Details for d2ocyb1

PDB Entry: 2ocy (more details), 3.3 Å

PDB Description: complex of the guanine exchange factor sec2p and the rab gtpase sec4p
PDB Compounds: (B:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2ocyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocyb1 h.1.33.1 (B:17-162) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrl
rediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrlteq
lrekdtlldtltlqlknlkkvmhsld

SCOPe Domain Coordinates for d2ocyb1:

Click to download the PDB-style file with coordinates for d2ocyb1.
(The format of our PDB-style files is described here.)

Timeline for d2ocyb1: