SCOPe 2.02: Domain d2o98b_: 2o98 B:

Lineage for d2o98b_ (2o98 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (4 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187162] (2 PDB entries)

8. Domain d2o98b_: 2o98 B: [138951]
   automated match to d1o9ca_
   complexed with fsc, so4

Details for d2o98b_

PDB Entry: 2o98, 2.7 Å

PDB Description: structure of the 14-3-3 / h+-atpase plant complex

PDB Compounds: (B:) 14-3-3-like protein c

SCOPe Domain Sequences for d2o98b_:

Sequence; same for both SEQRES and ATOM records:

>d2o98b_ a.118.7.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
svfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Timeline for d2o98b_:

• d2o98b_ first appeared in SCOP 1.73, called d2o98b1
  
• d2o98b_ appears in SCOPe 2.01
  
• d2o98b_ appears in SCOPe 2.03
  
• d2o98b_ appears in the current release, SCOPe 2.08