Lineage for d2o98a1 (2o98 A:5-240)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647251Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 647252Family a.118.7.1: 14-3-3 protein [48446] (2 proteins)
  6. 647253Protein 14-3-3-like protein C [89132] (1 species)
  7. 647254Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [89133] (5 PDB entries)
  8. 647256Domain d2o98a1: 2o98 A:5-240 [138950]
    automatically matched to d1o9ca_
    complexed with fsc, so4; mutant

Details for d2o98a1

PDB Entry: 2o98 (more details), 2.7 Å

PDB Description: structure of the 14-3-3 / h+-atpase plant complex
PDB Compounds: (A:) 14-3-3-like protein c

SCOP Domain Sequences for d2o98a1:

Sequence, based on SEQRES records: (download)

>d2o98a1 a.118.7.1 (A:5-240) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Sequence, based on observed residues (ATOM records): (download)

>d2o98a1 a.118.7.1 (A:5-240) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaelsykdstlimqllrdnltlwtsd

SCOP Domain Coordinates for d2o98a1:

Click to download the PDB-style file with coordinates for d2o98a1.
(The format of our PDB-style files is described here.)

Timeline for d2o98a1: