SCOPe 2.01: Domain d2o97a_: 2o97 A:

Lineage for d2o97a_ (2o97 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)

6. Protein HU protein [47735] (5 species)

7. Species Escherichia coli [TaxId:562] [101230] (2 PDB entries)

8. Domain d2o97a_: 2o97 A: [138949]
   automated match to d1mula_
   complexed with cl, ni

Details for d2o97a_

PDB Entry: 2o97, 2.45 Å

PDB Description: crystal structure of e. coli hu heterodimer

PDB Compounds: (A:) DNA-binding protein HU-alpha

SCOPe Domain Sequences for d2o97a_:

Sequence, based on SEQRES records:

>d2o97a_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraertg
rnpqtgkeikiaaanvpafvsgkalkdavk

Sequence, based on observed residues (ATOM records):

>d2o97a_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhnvpafv
sgkalkdavk

Timeline for d2o97a_:

• d2o97a_ first appeared in SCOP 1.73, called d2o97a1
  
• d2o97a_ was called d2o97a1 in SCOP 1.75
  
• d2o97a_ appears in SCOPe 2.02
  
• d2o97a_ appears in the current release, SCOPe 2.08