Class a: All alpha proteins [46456] (284 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) |
Protein HU protein [47735] (5 species) |
Species Escherichia coli [TaxId:562] [101230] (2 PDB entries) |
Domain d2o97a1: 2o97 A:1-90 [138949] automatically matched to d1mula_ complexed with cl, ni |
PDB Entry: 2o97 (more details), 2.45 Å
SCOP Domain Sequences for d2o97a1:
Sequence, based on SEQRES records: (download)
>d2o97a1 a.55.1.1 (A:1-90) HU protein {Escherichia coli [TaxId: 562]} mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraertg rnpqtgkeikiaaanvpafvsgkalkdavk
>d2o97a1 a.55.1.1 (A:1-90) HU protein {Escherichia coli [TaxId: 562]} mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhnvpafv sgkalkdavk
Timeline for d2o97a1: