Lineage for d2o92a1 (2o92 A:1-239,A:308-362)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094740Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2094918Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2094931Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries)
  8. 2094944Domain d2o92a1: 2o92 A:1-239,A:308-362 [138941]
    Other proteins in same PDB: d2o92a2
    automatically matched to d1ljya1

Details for d2o92a1

PDB Entry: 2o92 (more details), 3 Å

PDB Description: crystal structure of a signalling protein (spg-40) complex with tetrasaccharide at 3.0a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2o92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o92a1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlarv

SCOPe Domain Coordinates for d2o92a1:

Click to download the PDB-style file with coordinates for d2o92a1.
(The format of our PDB-style files is described here.)

Timeline for d2o92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o92a2