Lineage for d2o7na2 (2o7n A:129-307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892271Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 2892272Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 2892299Domain d2o7na2: 2o7n A:129-307 [138929]
    Other proteins in same PDB: d2o7na3
    automated match to d1lfaa_
    complexed with 2o7

Details for d2o7na2

PDB Entry: 2o7n (more details), 1.75 Å

PDB Description: cd11a (lfa1) i-domain complexed with 7a-[(4-cyanophenyl)methyl]-6-(3, 5-dichlorophenyl)-5-oxo-2,3,5,7a-tetrahydro-1h-pyrrolo[1,2-a]pyrrole- 7-carbonitrile
PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d2o7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7na2 c.62.1.1 (A:129-307) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
nvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyvk
rkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgni
daakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy

SCOPe Domain Coordinates for d2o7na2:

Click to download the PDB-style file with coordinates for d2o7na2.
(The format of our PDB-style files is described here.)

Timeline for d2o7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o7na3