SCOP 1.73: Domain d2o2vb1: 2o2v B:42-123

Lineage for d2o2vb1 (2o2v B:42-123)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142979] (2 PDB entries)

8. Domain d2o2vb1: 2o2v B:42-123 [138893]

Details for d2o2vb1

PDB Entry: 2o2v, 1.83 Å

PDB Description: crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)

PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 3

SCOP Domain Sequences for d2o2vb1:

Sequence; same for both SEQRES and ATOM records:

>d2o2vb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]}
qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
kaidildrsssmkslrilllsq

Timeline for d2o2vb1:

• d2o2vb1 is new in SCOP 1.73
  
• d2o2vb1 appears in SCOP 1.75
  
• d2o2vb1 appears in the current release, SCOPe 2.08