SCOP 1.75: Domain d2o1pb1: 2o1p B:202-351

Lineage for d2o1pb1 (2o1p B:202-351)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)

6. Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries)

8. Domain d2o1pb1: 2o1p B:202-351 [138878]
   Other proteins in same PDB: d2o1pa2, d2o1pa3, d2o1pb2, d2o1pb3
   automatically matched to d1fa0a3

Details for d2o1pb1

PDB Entry: 2o1p, 2.7 Å

PDB Description: Structure of yeast Poly(A) Polymerase in a somewhat closed state

PDB Compounds: (B:) poly(a) polymerase

SCOP Domain Sequences for d2o1pb1:

Sequence; same for both SEQRES and ATOM records:

>d2o1pb1 a.160.1.1 (B:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi
ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk
kvilqefvrgvqitndifsnkkswanlfek

Timeline for d2o1pb1:

• d2o1pb1 first appeared in SCOP 1.73
  
• d2o1pb1 appears in SCOPe 2.01
  
• d2o1pb1 appears in the current release, SCOPe 2.08