Lineage for d2o1pa2 (2o1p A:4-201)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686281Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 1686282Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 1686283Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries)
  8. 1686288Domain d2o1pa2: 2o1p A:4-201 [138876]
    Other proteins in same PDB: d2o1pa1, d2o1pa3, d2o1pb1, d2o1pb3
    automated match to d3c66a2

Details for d2o1pa2

PDB Entry: 2o1p (more details), 2.7 Å

PDB Description: Structure of yeast Poly(A) Polymerase in a somewhat closed state
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2o1pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1pa2 d.218.1.3 (A:4-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfv
yevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsl
lrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnldek
dlralngtrvtdeilelv

SCOPe Domain Coordinates for d2o1pa2:

Click to download the PDB-style file with coordinates for d2o1pa2.
(The format of our PDB-style files is described here.)

Timeline for d2o1pa2: