Lineage for d2o1na1 (2o1n A:1-133)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778208Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (53 PDB entries)
    Uniprot P59071
  8. 778264Domain d2o1na1: 2o1n A:1-133 [138874]
    automatically matched to d1cl5a_

Details for d2o1na1

PDB Entry: 2o1n (more details), 2.8 Å

PDB Description: crystal structure of a complex of phospholipase a2 with a peptide ala- ile-ala-ser at 2.8 a resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d2o1na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1na1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d2o1na1:

Click to download the PDB-style file with coordinates for d2o1na1.
(The format of our PDB-style files is described here.)

Timeline for d2o1na1: