Lineage for d2o0ua1 (2o0u A:46-400)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734769Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 734770Species Human (Homo sapiens) [TaxId:9606] [56138] (11 PDB entries)
  8. 734772Domain d2o0ua1: 2o0u A:46-400 [138868]
    automatically matched to d1jnk__
    complexed with c0m

Details for d2o0ua1

PDB Entry: 2o0u (more details), 2.1 Å

PDB Description: crystal structure of human jnk3 complexed with n-{3-cyano-6-[3-(1- piperidinyl)propanoyl]-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl}- 1-naphthalenecarboxamide
PDB Compounds: (A:) Mitogen-activated protein kinase 10

SCOP Domain Sequences for d2o0ua1:

Sequence, based on SEQRES records: (download)

>d2o0ua1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d2o0ua1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglarfmmtpyvvtryyr
apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
ddalqhpyinvwyrehtieewkeliykevmn

SCOP Domain Coordinates for d2o0ua1:

Click to download the PDB-style file with coordinates for d2o0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2o0ua1: