Lineage for d2nzvg1 (2nzv G:58-332)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710464Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 710465Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
  8. 710495Domain d2nzvg1: 2nzv G:58-332 [138856]
    Other proteins in same PDB: d2nzvl1
    automatically matched to d1sxga_
    complexed with fbp, so4

Details for d2nzvg1

PDB Entry: 2nzv (more details), 3 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
PDB Compounds: (G:) Catabolite control protein

SCOP Domain Sequences for d2nzvg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzvg1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk

SCOP Domain Coordinates for d2nzvg1:

Click to download the PDB-style file with coordinates for d2nzvg1.
(The format of our PDB-style files is described here.)

Timeline for d2nzvg1: