SCOPe 2.07: Domain d2nzul_: 2nzu L:

Lineage for d2nzul_ (2nzu L:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
   Uniprot O69250

8. Domain d2nzul_: 2nzu L: [138855]
   Other proteins in same PDB: d2nzug_
   automated match to d1rzrl_
   complexed with bg6, so4

Details for d2nzul_

PDB Entry: 2nzu, 2.5 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp

PDB Compounds: (L:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2nzul_:

Sequence; same for both SEQRES and ATOM records:

>d2nzul_ d.94.1.1 (L:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

Timeline for d2nzul_:

• d2nzul_ first appeared in SCOP 1.73, called d2nzul1
  
• d2nzul_ appears in SCOPe 2.06
  
• d2nzul_ appears in the current release, SCOPe 2.08