SCOP 1.75: Domain d2nzug1: 2nzu G:58-332

Lineage for d2nzug1 (2nzu G:58-332)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
   Uniprot P46828 58-322
   Uniprot P46828
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d2nzug1: 2nzu G:58-332 [138854]
   Other proteins in same PDB: d2nzul1
   automatically matched to d1sxga_
   complexed with bg6, so4

Details for d2nzug1

PDB Entry: 2nzu, 2.5 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp

PDB Compounds: (G:) Catabolite control protein

SCOP Domain Sequences for d2nzug1:

Sequence; same for both SEQRES and ATOM records:

>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk

Timeline for d2nzug1:

• d2nzug1 first appeared in SCOP 1.73
  
• d2nzug1 is called d2nzug_ in SCOPe 2.01
  
• d2nzug1 appears in the current release, SCOPe 2.08, called d2nzug_