SCOPe 2.01: Domain d2nzdf1: 2nzd F:24-102

Lineage for d2nzdf1 (2nzd F:24-102)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)

8. Domain d2nzdf1: 2nzd F:24-102 [138852]
   Other proteins in same PDB: d2nzda_, d2nzdc_, d2nzde_, d2nzdg_
   automatically matched to d1p3ob_
   protein/DNA complex; complexed with mn

Details for d2nzdf1

PDB Entry: 2nzd, 2.65 Å

PDB Description: Nucleosome core particle containing 145 bp of DNA

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d2nzdf1:

Sequence; same for both SEQRES and ATOM records:

>d2nzdf1 a.22.1.1 (F:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d2nzdf1:

• d2nzdf1 first appeared in SCOP 1.73
  
• d2nzdf1 appears in SCOP 1.75
  
• d2nzdf1 is called d2nzdf_ in SCOPe 2.02
  
• d2nzdf1 appears in the current release, SCOPe 2.08, called d2nzdf_